DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL3 and CG17375

DIOPT Version :9

Sequence 1:NP_610018.1 Gene:AANATL3 / 35285 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_609076.3 Gene:CG17375 / 33956 FlyBaseID:FBgn0031861 Length:268 Species:Drosophila melanogaster


Alignment Length:244 Identity:49/244 - (20%)
Similarity:87/244 - (35%) Gaps:63/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DGITIRTMTKEDYPSVKAFLKDNFFQSEPLCQSTSENVQSQNEKENDEYHLSMIAQGTC---LVA 68
            :|:.|..:..:.|..|..|:..|.|....:.:|.. .....:.|:...:::..|.:..|   :::
  Fly    17 EGMQIVDINSKYYDMVIEFMWSNSFLKSLVYESLG-LFDLPDMKQTYSWYVRHILRNECSVMMIS 80

  Fly    69 IDESNGGKFVGLVLAGAQYPEDLEKHRIEAESMEQHFWARACIMLSKIEREANLFER-------- 125
            .||:. .:.|||               :|..:.|.|.|.   ...|.:.|  |||::        
  Fly    81 EDETQ-IRAVGL---------------LEWMTEEWHSWV---FFPSSLPR--NLFQQIIMMKKEL 124

  Fly   126 -------FGIS--KLLYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYC--TSF--YS 177
                   .|||  ..|:.|..:....:.   ......:|:.||   .||.|...:.  .||  .|
  Fly   125 IDATKANMGISTYDALFVHEIAFPDELY---FNRDFLSTIFDV---FGFVAQHMHMPRVSFIALS 183

  Fly   178 ARQKEALGM-------KCVHSLPYADYKDDQGRPIFTPAEPHTMARIMF 219
            :..:||..:       :.::|:    ||....||.....|...|..::|
  Fly   184 SVDQEAASLIDYEEIGRTIYSI----YKVGNTRPFDILRELDEMYALLF 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 16/80 (20%)
CG17375NP_609076.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.