DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL3 and AANATL7

DIOPT Version :9

Sequence 1:NP_610018.1 Gene:AANATL3 / 35285 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001188542.1 Gene:AANATL7 / 31236 FlyBaseID:FBgn0040376 Length:228 Species:Drosophila melanogaster


Alignment Length:208 Identity:55/208 - (26%)
Similarity:91/208 - (43%) Gaps:12/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RTMTKEDYPSVKAFLKDNFFQSEP------LCQSTSE-NVQSQNEKENDEYHLSMIAQGTCLVAI 69
            :.:..|....|...|:.|||..||      |||:.|. .....:..|..::.:|::|     |..
  Fly     4 KMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAEAIQHRMSVMA-----VDA 63

  Fly    70 DESNGGKFVGLVLAGAQYPEDLEKHRIEAESMEQHFWARACIMLSKIEREANLFERFGISKLLYS 134
            .|.:..|.||:||.|...|.|..|...:.:..:...:.:...:|.:...:.||||.|.:..:...
  Fly    64 KEKDTLKIVGVVLNGILKPGDTAKALSKLDCNDDADFRKIFDLLHRHNLKHNLFEHFDVDCMFDV 128

  Fly   135 HITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALGMKCVHSLPYADYKD 199
            .|.||:|..||:|:.:.|....:.|.:..||..:.|..|..:|.:...:.|.:.....||:.|.|
  Fly   129 RILSVDSCYRGQGIANELVKRSVAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTD 193

  Fly   200 DQGRPIFTPAEPH 212
            :.|:.|.....||
  Fly   194 ENGKVILPVEAPH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 18/59 (31%)
AANATL7NP_001188542.1 NAT_SF <128..187 CDD:302625 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435034
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20905
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.