Sequence 1: | NP_610018.1 | Gene: | AANATL3 / 35285 | FlyBaseID: | FBgn0032839 | Length: | 222 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_503329.2 | Gene: | R13D11.4 / 187863 | WormBaseID: | WBGene00020058 | Length: | 227 | Species: | Caenorhabditis elegans |
Alignment Length: | 225 | Identity: | 47/225 - (20%) |
---|---|---|---|
Similarity: | 88/225 - (39%) | Gaps: | 42/225 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KDGITIRTMTKEDYPSVKAFLKDNFFQSEPLCQSTSENVQSQNEKENDEYHLSMIAQGTCLV--- 67
Fly 68 -AIDESNGGKFVGLVLAGAQYPEDLEKHRIEAESMEQH-----FW---ARACIMLSKI--EREAN 121
Fly 122 LFE-RFGISKLLYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALG 185
Fly 186 MKCV----------HSLPYADYKDDQGRPI 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
AANATL3 | NP_610018.1 | NAT_SF | <122..182 | CDD:302625 | 16/60 (27%) |
R13D11.4 | NP_503329.2 | Acetyltransf_1 | <130..191 | CDD:366181 | 16/67 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2E94Y | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR20905 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.000 |