DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL3 and R05H10.1

DIOPT Version :9

Sequence 1:NP_610018.1 Gene:AANATL3 / 35285 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 / 175144 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans


Alignment Length:249 Identity:46/249 - (18%)
Similarity:83/249 - (33%) Gaps:71/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RTMTKEDYPSVKAFLKDNFFQSEPLCQST-------------------------------SENV- 44
            ||..|.|:..:..||.::|:..||..:::                               .||: 
 Worm     8 RTAEKSDFDRILKFLAEHFYHEEPSIRASKIALEEWLPIFGEMTTSSLKLPISTVVTTEDGENIV 72

  Fly    45 ----QSQNEKENDEYHLSM-IAQGTCLVAIDESNGGKFVGLVLAGAQYPEDLEKHRIEAESMEQH 104
                .|...:|.||..:.. ..:|      |....|           |.|.|::.....:.....
 Worm    73 AVLLNSMWSREEDEERMKHGNGKG------DHDTSG-----------YSEALQRFMTIVQKCHDE 120

  Fly   105 FWARACIMLSKIEREANLFERFGISKLLYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMT 169
            ||..|       ..:.||        ::|..|:||....:.:|:.:::.:..|...|......:.
 Worm   121 FWNLA-------PSDVNL--------VVYREISSVGKPWQRQGIATKMLSRNMSAARLHNVDGIV 170

  Fly   170 AYCTSFYSARQKEALGMKCVHSLPYADYKDDQG-RPIFTPAEPHTMARIMFIKL 222
            :..:||.:.......|.:|:...||:......| :.:.|....|.| ||.|.::
 Worm   171 SATSSFANQTLLAKNGFQCLKEFPYSGIVSSNGDKLVETDDGSHGM-RINFKRI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 10/59 (17%)
R05H10.1NP_497076.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E94Y
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185856at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.