DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and APOBEC3B

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_004891.5 Gene:APOBEC3B / 9582 HGNCID:17352 Length:382 Species:Homo sapiens


Alignment Length:41 Identity:10/41 - (24%)
Similarity:15/41 - (36%) Gaps:16/41 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 MNIFVYDELPVTFD----------------EEHQKAQLQRI 158
            ::|..|||....:|                |||.:|...|:
Human   333 VSIMTYDEFEYCWDTFVYRQGCPFQPWDGLEEHSQALSGRL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 10/41 (24%)
APOBEC3BNP_004891.5 APOBEC_N 17..187 CDD:311913
APOBEC_N 198..374 CDD:311913 10/41 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.