powered by:
Protein Alignment COX4 and APOBEC3B
DIOPT Version :9
Sequence 1: | NP_001260612.1 |
Gene: | COX4 / 35279 |
FlyBaseID: | FBgn0032833 |
Length: | 182 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_004891.5 |
Gene: | APOBEC3B / 9582 |
HGNCID: | 17352 |
Length: | 382 |
Species: | Homo sapiens |
Alignment Length: | 41 |
Identity: | 10/41 - (24%) |
Similarity: | 15/41 - (36%) |
Gaps: | 16/41 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 MNIFVYDELPVTFD----------------EEHQKAQLQRI 158
::|..|||....:| |||.:|...|:
Human 333 VSIMTYDEFEYCWDTFVYRQGCPFQPWDGLEEHSQALSGRL 373
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
COX4 | NP_001260612.1 |
COX4 |
50..181 |
CDD:281003 |
10/41 (24%) |
APOBEC3B | NP_004891.5 |
APOBEC_N |
17..187 |
CDD:311913 |
|
APOBEC_N |
198..374 |
CDD:311913 |
10/41 (24%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4075 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.