DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and COX5A

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_014346.1 Gene:COX5A / 855675 SGDID:S000004997 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:117 Identity:23/117 - (19%)
Similarity:48/117 - (41%) Gaps:28/117 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PTNE----INALRAKEQGDWKKLSTQEIKALYRASFCQTIAEVQAGSGEW-----KLHLGVSLLF 123
            |:.|    ::.|..:::..|.:|:..|.:|::..|:           |||     .|:.|.| .|
Yeast    42 PSTEQQDIVSKLSERQKLPWAQLTEPEKQAVWYISY-----------GEWGPRRPVLNKGDS-SF 94

  Fly   124 CAAAIWVAVLMNIFVYDELPV-------TFDEEHQKAQLQRIIDLEINPVTG 168
            .|..:...:|.::.::..:.:       |.::|.|....:.:.....||..|
Yeast    95 IAKGVAAGLLFSVGLFAVVRMAGGQDAKTMNKEWQLKSDEYLKSKNANPWGG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 23/117 (20%)
COX5ANP_014346.1 COX4 34..152 CDD:397197 23/117 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - LDO PTHR10707
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X922
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.