DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and Cox4i2

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_444321.1 Gene:Cox4i2 / 84682 MGIID:2135755 Length:172 Species:Mus musculus


Alignment Length:135 Identity:57/135 - (42%)
Similarity:77/135 - (57%) Gaps:8/135 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CYADRVDYPLPAVRF-REPTNEINALRAKEQGDWKKLSTQEIKALYRASFCQTIAEVQAGSGEWK 114
            |||.| .||:|...| .|.:.|..||:.||:|.|.:||..|..||||..|.:|.||:...|.|||
Mouse    41 CYAQR-SYPMPDEPFCTELSEEQRALKEKEKGSWTQLSQAEKVALYRLQFHETFAEMNHRSNEWK 104

  Fly   115 LHLGVSLL---FCAAAIWVAVLMNIFVYDELPVTFDEEHQKAQLQRIIDLEINPVTGLTSKWDYE 176
            ..:|....   |.|..||   ...::|:.:..||..||.:..||||::|::.||:.||.:.||||
Mouse   105 TVMGCVFFFIGFTALVIW---WQRVYVFPKKVVTLTEERKAQQLQRLLDMKSNPIQGLAAHWDYE 166

  Fly   177 NKKWK 181
            .|:||
Mouse   167 KKEWK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 55/133 (41%)
Cox4i2NP_444321.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..32
COX4 38..171 CDD:367258 55/133 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841626
Domainoid 1 1.000 106 1.000 Domainoid score I6576
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4913
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48902
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm8824
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.990

Return to query results.
Submit another query.