DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and cox4i1

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001016479.1 Gene:cox4i1 / 549233 XenbaseID:XB-GENE-953648 Length:169 Species:Xenopus tropicalis


Alignment Length:167 Identity:57/167 - (34%)
Similarity:89/167 - (53%) Gaps:23/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LDKIGKREIVGYGWNGTAC-----------------YADRVDYPLPAVRFREP-TNEINALRAKE 79
            |..:|:|.:     :.:||                 |.||.:.|||.:.|.|. ::|..||:.||
 Frog     7 LSLVGRRAL-----STSACLQGHAAVVKPETYSLPVYVDRRNVPLPDIAFVETLSSEQKALKEKE 66

  Fly    80 QGDWKKLSTQEIKALYRASFCQTIAEVQAGSGEWKLHLGVSLLFCAAAIWVAVLMNIFVYDELPV 144
            :|.|..||.:|...|||..|.::.:|:..||.|||..||.:|.|.....:|.:....:||.::|.
 Frog    67 KGTWASLSAKEKLELYRIKFQESYSEMNQGSSEWKTILGGTLFFIGFTAFVILWQRKYVYGDVPH 131

  Fly   145 TFDEEHQKAQLQRIIDLEINPVTGLTSKWDYENKKWK 181
            ||.::....|.:|::|:.|||:.|.:|||||:..:||
 Frog   132 TFSDDWVAKQAKRMLDMRINPIQGFSSKWDYDKNEWK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 52/148 (35%)
cox4i1NP_001016479.1 COX4 36..168 CDD:367258 50/131 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6266
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4745
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm9486
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X922
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.