DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and cox4i1l

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001373397.1 Gene:cox4i1l / 402880 ZFINID:ZDB-GENE-130814-2 Length:173 Species:Danio rerio


Alignment Length:187 Identity:65/187 - (34%)
Similarity:96/187 - (51%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLLNSAVLRQLASQLPKSAQVGSVAAVHTLDKIGKREIVGYGWNGTAC----YADRVDYPLPAV 63
            :|.|.|...|:|::.       ..:.|.||.|.           :.|.|    |.:|:|.|||.|
Zfish     8 VRGLQSGFWRRLSTS-------SGIWAAHTHDV-----------DVTDCSVPQYNNRLDTPLPDV 54

  Fly    64 RF-REPTNEINALRAKEQGDWKKLSTQEIKALYRASFCQTIAEVQAGSGEWKLHL-GV--SLLFC 124
            .| |..:.|...|:.||:|.|.:||.:|..|:||.:...:..|::.||.||...| ||  .|.|.
Zfish    55 PFVRNLSAEQKKLKEKEKGPWTQLSKEEKLAIYRLTHELSFPEMRKGSKEWMTVLAGVFFFLGFT 119

  Fly   125 AAAIWVAVLMNIFVYDELPVTFDEEHQKAQLQRIIDLEINPVTGLTSKWDYENKKWK 181
            ...:|   ...:|||.::|.|..:|..:.|.||::|:::||:||...|||||.|:||
Zfish   120 GLLVW---WQRVFVYGDVPHTLSQEWIEKQTQRMLDMKVNPITGFAHKWDYEKKQWK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 53/138 (38%)
cox4i1lNP_001373397.1 COX4 41..173 CDD:397197 52/134 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585958
Domainoid 1 1.000 113 1.000 Domainoid score I6082
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4826
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm6589
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - O PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.