powered by:
Protein Alignment COX4 and Aicda
DIOPT Version :9
Sequence 1: | NP_001260612.1 |
Gene: | COX4 / 35279 |
FlyBaseID: | FBgn0032833 |
Length: | 182 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001094249.1 |
Gene: | Aicda / 399679 |
RGDID: | 1303222 |
Length: | 198 |
Species: | Rattus norvegicus |
Alignment Length: | 92 |
Identity: | 19/92 - (20%) |
Similarity: | 30/92 - (32%) |
Gaps: | 46/92 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 KKLSTQEIKALYRASFCQTIAEVQAGSGEWKLHLGVSLLFCAAAIWVAVLMNIFVYDELPVTFDE 148
:|...:.::.|:||. ||.|...:| ...:| | |.|| |
Rat 119 RKAEPEGLRRLHRAG-------VQIGIMTFK-----DYFYC----W-----NTFV---------E 153
Fly 149 EHQKA----------------QLQRII 159
.|::. ||:||:
Rat 154 NHERTFKAWEGLHENSVRLTRQLRRIL 180
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
COX4 | NP_001260612.1 |
COX4 |
50..181 |
CDD:281003 |
19/92 (21%) |
Aicda | NP_001094249.1 |
APOBEC2 |
6..180 |
CDD:408543 |
18/90 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4075 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.