DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and cox4i2

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_957097.1 Gene:cox4i2 / 393776 ZFINID:ZDB-GENE-040426-1775 Length:177 Species:Danio rerio


Alignment Length:131 Identity:52/131 - (39%)
Similarity:79/131 - (60%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YADRVDYPLPAVRFREPTNEIN-ALRAKEQGDWKKLSTQEIKALYRASFCQTIAEVQAGSGEWKL 115
            |:||:|.|||...:::..:..: :|:.||:|.|..||.:|..||||..|.:|.||::..:||||.
Zfish    47 YSDRLDTPLPDRPYKDILSAADKSLKQKEKGPWNNLSNEEKIALYRIMFNETFAEMKKPTGEWKT 111

  Fly   116 HLGVSLLFCAAAIWVAVLMNIFVYDELPVTFDEEHQKAQLQRIIDLEINPVTGLTSKWDYENKKW 180
            .....|.|......|.:...::||...|.||.:|.|..|::|::|::||||.|..:|||||..:|
Zfish   112 VTAGILFFIGFTGLVVLWQRLYVYPPQPHTFGDEWQAKQIKRMLDMKINPVQGFAAKWDYEKGQW 176

  Fly   181 K 181
            |
Zfish   177 K 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 50/129 (39%)
cox4i2NP_957097.1 COX4 45..177 CDD:281003 50/129 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585954
Domainoid 1 1.000 113 1.000 Domainoid score I6082
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H101821
Inparanoid 1 1.050 113 1.000 Inparanoid score I4826
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm6589
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - LDO PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.