DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and cox5

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_588158.2 Gene:cox5 / 2538862 PomBaseID:SPCC338.10c Length:186 Species:Schizosaccharomyces pombe


Alignment Length:186 Identity:38/186 - (20%)
Similarity:72/186 - (38%) Gaps:42/186 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LNSAVLRQLASQL--PKSAQVGSVAAVHTLDK--------IGKREIVGYGWNGTACYADRVDYPL 60
            |:..:.:::..:|  .::|...|.||.:.|.|        |.:..:|.            :|...
pombe     3 LSKIICKKVPMKLLCTRNAATVSAAATNALQKEQPSGEAMIARPRLVD------------LDKRW 55

  Fly    61 PAVRFREPTNEINALRAKEQGDWKKLSTQEIKALYRASFCQTIAEVQAGSGEWK----LHLGVSL 121
            ..:...|....|..|.|:::..|..||.:|.||.|..:|           ||..    .|:....
pombe    56 GIMSQEEKDGLITDLYARQKQPWTTLSIEEKKAAYWIAF-----------GEHGPRAFSHISQKT 109

  Fly   122 LF--CAAAIWVAVLMNIFVYDEL---PVTFDEEHQKAQLQRIIDLEINPVTGLTSK 172
            :|  ..|.:.:.|::...:..:.   |.|...|.|:...:.:.:.:|||::|..|:
pombe   110 VFWGTVAGLTIGVVLFGLIRTQAAPSPRTMTREWQEKSNEYMKENKINPISGEASE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 28/132 (21%)
cox5NP_588158.2 Cyt_c_Oxidase_IV 36..168 CDD:238462 30/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4075
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - LDO PTHR10707
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.