DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and Cox4i1

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_034071.2 Gene:Cox4i1 / 12857 MGIID:88473 Length:206 Species:Mus musculus


Alignment Length:175 Identity:59/175 - (33%)
Similarity:87/175 - (49%) Gaps:23/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GSVAAVHTLDKIGKREIVGYGWNGTAC-----------------YADRVDYPLPAV-RFREPTNE 71
            |.:.|...|..||||.|     :.:.|                 ||||.|||||.| .....:..
Mouse    36 GRMLASRALSLIGKRAI-----STSVCLRAHGSVVKSEDYAFPTYADRRDYPLPDVAHVTMLSAS 95

  Fly    72 INALRAKEQGDWKKLSTQEIKALYRASFCQTIAEVQAGSGEWKLHLGVSLLFCAAAIWVAVLMNI 136
            ..||:.||:.||..||..|...|||..|.::.||:..|:.|||..:|:::.|......|.:....
Mouse    96 QKALKEKEKADWSSLSRDEKVQLYRIQFNESFAEMNRGTNEWKTVVGMAMFFIGFTALVLIWEKS 160

  Fly   137 FVYDELPVTFDEEHQKAQLQRIIDLEINPVTGLTSKWDYENKKWK 181
            :||..:|.|||.:....|.:|::|::.||:.|.::||||:..:||
Mouse   161 YVYGPIPHTFDRDWVAMQTKRMLDMKANPIQGFSAKWDYDKNEWK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 49/148 (33%)
Cox4i1NP_034071.2 COX4 73..205 CDD:281003 48/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841628
Domainoid 1 1.000 106 1.000 Domainoid score I6576
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4913
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm8824
orthoMCL 1 0.900 - - OOG6_103849
Panther 1 1.100 - - O PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.