DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and Aicda

DIOPT Version :10

Sequence 1:NP_610013.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_033775.1 Gene:Aicda / 11628 MGIID:1342279 Length:198 Species:Mus musculus


Alignment Length:84 Identity:20/84 - (23%)
Similarity:33/84 - (39%) Gaps:30/84 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KKLSTQEIKALYRASFCQTIAEVQAGSGEWKLHLGVSLLFCAAAIWVAVLMNIFVYDELPVTF-- 146
            :|...:.::.|:||.       ||.|...:|     ...:|    |     |.|| :....||  
Mouse   119 RKAEPEGLRRLHRAG-------VQIGIMTFK-----DYFYC----W-----NTFV-ENRERTFKA 161

  Fly   147 -DEEHQKA-----QLQRII 159
             :..|:.:     ||:||:
Mouse   162 WEGLHENSVRLTRQLRRIL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_610013.1 Cyt_c_Oxidase_IV 40..175 CDD:238462 20/84 (24%)
AicdaNP_033775.1 Bipartite nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q9GZX7 1..30
Interaction with SUPT6H. /evidence=ECO:0000250|UniProtKB:Q9GZX7 2..26
NAD1 5..180 CDD:465865 19/82 (23%)
Important for interaction with CTNNBL1. /evidence=ECO:0000250|UniProtKB:Q9GZX7 39..42
Required for interaction with RNF126. /evidence=ECO:0000250|UniProtKB:Q9GZX7 88..116
Nuclear export signal. /evidence=ECO:0000250|UniProtKB:Q9GZX7 183..198
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.