DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX4 and LOC100127750

DIOPT Version :9

Sequence 1:NP_001260612.1 Gene:COX4 / 35279 FlyBaseID:FBgn0032833 Length:182 Species:Drosophila melanogaster
Sequence 2:XP_017950442.1 Gene:LOC100127750 / 100127750 -ID:- Length:180 Species:Xenopus tropicalis


Alignment Length:196 Identity:74/196 - (37%)
Similarity:100/196 - (51%) Gaps:41/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLLNSAVLRQLASQLPKSAQVGSVAAVHTLDKIGKREIVGYGWNGTA---------CYADRVDY 58
            ||...|...|.|::..|.||         |||:         |::.|.         .|.:|.:|
 Frog     9 LRGARSVTWRSLSTTSPVSA---------TLDR---------GYDITTNKPIDFTKPMYCERREY 55

  Fly    59 PLPAVRFREPTNEIN----ALRAKEQGDWKKLSTQEIKALYRASFCQTIAEVQAGS-GEWKLHLG 118
            |||.|.|   .:|:|    ||:.||.|.|.:|:.:|..||||.||.|:.||:.:|| .|||..:|
 Frog    56 PLPDVPF---VSELNPQQKALKLKENGPWGQLTKEEKLALYRISFNQSYAEMHSGSKSEWKTIVG 117

  Fly   119 VSLLFCAAA---IWVAVLMNIFVYDELPVTFDEEHQKAQLQRIIDLEINPVTGLTSKWDYENKKW 180
            ..|.|.|..   :|   ...|:||..:|.|..|:....|.:|:||:.||||||.:|.||||.|:|
 Frog   118 AVLYFLAFGGLYLW---WHRIYVYGPVPHTLSEDWVAMQAKRMIDMRINPVTGFSSHWDYEKKQW 179

  Fly   181 K 181
            |
 Frog   180 K 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX4NP_001260612.1 COX4 50..181 CDD:281003 59/147 (40%)
LOC100127750XP_017950442.1 COX4 47..180 CDD:367258 59/138 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6266
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4745
OMA 1 1.010 - - QHG48902
OrthoDB 1 1.010 - - D1591226at2759
OrthoFinder 1 1.000 - - FOG0002054
OrthoInspector 1 1.000 - - mtm9486
Panther 1 1.100 - - LDO PTHR10707
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4386
SonicParanoid 1 1.000 - - X922
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.