DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TotE and TotX

DIOPT Version :10

Sequence 1:NP_788077.2 Gene:TotE / 35275 FlyBaseID:FBgn0053117 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_536781.2 Gene:TotX / 117460 FlyBaseID:FBgn0044810 Length:142 Species:Drosophila melanogaster


Alignment Length:104 Identity:31/104 - (29%)
Similarity:50/104 - (48%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LQISCLL--VVLGCLLGSGHCQSEAEFAAKSREIAQVFGNPSVDKYTKARNLPTLIAFYEKYSSR 82
            |.|..||  |.||.:..:....:.:.:......:..:|.||.|:...|.:|:|.|||||::|.:.
  Fly     3 LSIGSLLICVFLGIVPFATANTNSSSYEEHRNYLLNIFHNPFVNDSIKEKNIPQLIAFYQRYPTD 67

  Fly    83 LRLTPQERISINNAMRQYKAQRNQQVDGVSAQGGWLSDI 121
            :.|:..:|......:..|:..|...|||...|||...:|
  Fly    68 VPLSDADRQQFERFIHDYREYRAVLVDGAPPQGGSFGNI 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TotENP_788077.2 Turandot 59..133 CDD:399906 21/63 (33%)
TotXNP_536781.2 Turandot 45..125 CDD:399906 21/62 (34%)

Return to query results.
Submit another query.