DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10481 and VTC3

DIOPT Version :9

Sequence 1:NP_995731.1 Gene:CG10481 / 35273 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_015306.1 Gene:VTC3 / 856088 SGDID:S000005940 Length:835 Species:Saccharomyces cerevisiae


Alignment Length:199 Identity:50/199 - (25%)
Similarity:71/199 - (35%) Gaps:60/199 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVE 65
            |.||..|.|.:.|.|:..|::|..||::::   |......|.|.|   .:....|..|..:...|
Yeast     1 MLFGIKLANDVYPPWKDSYIDYERLKKLLK---ESVIHDGRSSVD---SWSERNESDFVEALDKE 59

  Fly    66 LTKVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKLR 130
            |.||..|...|.....|||..|.                             |..:....|:|:.
Yeast    60 LEKVYTFQISKYNAVLRKLDDLE-----------------------------ENTKSAEKIQKIN 95

  Fly   131 LAMSEFYLSLI--------MLQNYQTLNMTAFRKICKKYDK---NLKSEAGFAWYEKYVLKSTLA 184
               ||.:.:.:        .|.|:..||.|.|.||.||:||   |..|           :||.|.
Yeast    96 ---SEQFKNTLEECLDEAQRLDNFDRLNFTGFIKIVKKHDKLHPNYPS-----------VKSLLQ 146

  Fly   185 ITLQ 188
            :.|:
Yeast   147 VRLK 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 41/168 (24%)
SPX 3..163 CDD:281146 41/167 (25%)
EXS 267..601 CDD:281164
VTC3NP_015306.1 COG5036 1..561 CDD:227369 50/199 (25%)
VTC1 673..803 CDD:227589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.790

Return to query results.
Submit another query.