DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10481 and ERD1

DIOPT Version :9

Sequence 1:NP_995731.1 Gene:CG10481 / 35273 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_010702.4 Gene:ERD1 / 852023 SGDID:S000002822 Length:362 Species:Saccharomyces cerevisiae


Alignment Length:440 Identity:96/440 - (21%)
Similarity:163/440 - (37%) Gaps:113/440 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 LDRMISTTENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLGLFLVSAILCFISYFA 253
            :::..|.:|.:|...:.|                  .||...|...:.|.|::.:.||.|..:..
Yeast     1 MEKSESNSEGLYLQNILN------------------VPPPQRFIVLIILALWIWTWILKFFLHSN 47

  Fly   254 VDTSP--------EFR--YTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIG 308
            :|.|.        :.|  ||...|.|     ....|.|.|. ::........|.:||.       
Yeast    48 LDVSQVILTRVPHDIRPGYTLQQLHR-----TARNFALKIT-RIIIPFHFATVFLFEF------- 99

  Fly   309 AMRALEISSFFGYMCTLSILLYLLHKEFFIEDPIYIPLVQVAFVVVLFLNPFRILFYSGRIWLLT 373
             |..:|     |.:..:.:::|            ::||:|...:....|...:|:.|..|..|| 
Yeast   100 -MNIIE-----GPLKNIILIVY------------FLPLIQCVTIFWFLLKECQIIKYCTRRCLL- 145

  Fly   374 VMGRILLSPFFFVNFADFWVADQWTSLVVTIVDHYYLVRFYVRYFLDRSDAFEFEP----DYAVA 434
                |..||....| ....::|..||....::|.........|           ||    |.:||
Yeast   146 ----IESSPRSLRN-TYILISDTLTSFAKPLIDFTLFTSLIFR-----------EPFTHFDLSVA 194

  Fly   435 VIRCLPAWFRFAQSLRRFRDSGSKSTDYLINALKY-----FLFI---AEVVFSTIQMETIAHYTD 491
            :   ||...|..|.||.:|  .......|.|||||     .||.   :.|...:|..|.:.|...
Yeast   195 L---LPVLVRLLQCLREYR--LLHEATLLFNALKYSCNLPILFCTWRSRVYEGSINEERLHHVQR 254

  Fly   492 LFESPWTWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLRDNLVYPRWFYYFVIVENTLLR 556
            .|           .:::|.||:|||:.||:.|..:.:..:: .:..:...:..|:..|:.:.|||
Yeast   255 WF-----------MLINSSYTLFWDVRMDWSLDSLTSLRSR-SKSAVTLKKKMYHSAILVDFLLR 307

  Fly   557 CVWILEFALVHQELIAP------YNGKSLICFSEIARRFFWNFLRLENEH 600
            ..|:..:...:.:|:|.      :.|:  :.:.|:.||..|...:|:.|:
Yeast   308 FWWLWVYLSQNLKLVAADSDYIFFQGE--MQYFEVIRRGIWVVFKLDAEY 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898
SPX 3..163 CDD:281146
EXS 267..601 CDD:281164 79/352 (22%)
ERD1NP_010702.4 EXS 1..362 CDD:413852 96/440 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.569298 Normalized mean entropy S1995
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.