DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10481 and SPX4

DIOPT Version :9

Sequence 1:NP_995731.1 Gene:CG10481 / 35273 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001330175.1 Gene:SPX4 / 831385 AraportID:AT5G15330 Length:387 Species:Arabidopsis thaliana


Alignment Length:232 Identity:52/232 - (22%)
Similarity:89/232 - (38%) Gaps:59/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFGKTLDNLM---VPEWRYQYMNYNELKQMIR---------------------------NAVEK 35
            |||||.....:   :||||.:::.|..||::::                           |....
plant    70 MKFGKEFRTHLEETLPEWRDKFLCYKPLKKLLKYYPYYSADFGPANSDHNDSRPVFADTTNISSA 134

  Fly    36 APSGS-----RPSNDVAIGYYRNFEELFFNSCRVELTKVNYFFAHKQAEAHRKLATLNYQLDRRR 95
            |..|.     |||.|:...:.|...:        ||.|.|.|:..|:.:...:|..|..::::  
plant   135 ADDGGVVPGVRPSEDLQGSFVRILND--------ELEKFNDFYVDKEEDFVIRLQELKERIEQ-- 189

  Fly    96 AQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKLRLAMSEFYLSLIMLQNYQTLNMTAFRKICKK 160
             .::..|..||.   |.:|.:         :..:|..:...:..:::|:||.:||.....||.||
plant   190 -VKEKNGEFASE---SEFSEE---------MMDIRRDLVTIHGEMVLLKNYSSLNFAGLVKILKK 241

  Fly   161 YDKNLKSEAGFAWYEKYVLKSTLAITLQLDRMISTTE 197
            |||......... :.:.||......|..|.|::...|
plant   242 YDKRTGGLLRLP-FTQLVLHQPFFTTEPLTRLVRECE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 43/195 (22%)
SPX 3..163 CDD:281146 42/194 (22%)
EXS 267..601 CDD:281164
SPX4NP_001330175.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.