DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10481 and AT4G22990

DIOPT Version :9

Sequence 1:NP_995731.1 Gene:CG10481 / 35273 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001190805.1 Gene:AT4G22990 / 828398 AraportID:AT4G22990 Length:700 Species:Arabidopsis thaliana


Alignment Length:385 Identity:77/385 - (20%)
Similarity:132/385 - (34%) Gaps:118/385 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FGKTLDNLMVPEWRYQYMNYNELKQMIRNAVEKAPSGSRPSNDVAIGYYRNFEELFFNSCRVELT 67
            |||.|....:.||:..|:||..:|:.::....:...|:.....|    .::|..:..|    ::.
plant     4 FGKKLKERSIQEWQGYYINYKLMKKKVKQYSRQLEGGNLERRHV----LKDFSRMLDN----QIE 60

  Fly    68 KVNYFFAHKQAEAHRKLATLNYQLDRRRAQQDPRGSTASRGSASSWSRQPEGKRKFPPIKKLRLA 132
            |:..|...:|.....:|.||                   |||..:...||:       |..:...
plant    61 KIALFMLEQQGLLASRLQTL-------------------RGSHDALQEQPD-------ISHMSYL 99

  Fly   133 MSEFYL---SLIMLQNYQTLNMTAFRKICKKYDKNLKSEAGFAWYEKYV----------LKSTL- 183
            ..|:..   .|:.|..:..:|....|||.||:||..    |:.:...||          |:... 
plant   100 KEEYRAVGQDLLKLLFFVEMNAIGIRKILKKFDKRF----GYRFTNYYVKTRANHPYSELQQVFR 160

  Fly   184 -----AITLQLDRMISTTENMYTDYLANGDRSEAMAKLRVPPLGHPTPPVHVFSAGLFLGLFLVS 243
                 |:...:.|.:...:|....||:..|:         |.|....|.|....|.:. .|...:
plant   161 HVGLGAVVGAVSRNLHELQNNQGSYLSIYDQ---------PVLPLQDPVVDSIRAAVD-RLTRST 215

  Fly   244 AILCFISYFAVDTSPEF-------------RYTFVSLFRGPISGVTFGFCL------------AI 283
            ..|.|::..|:....|.             ||.|:||....::  ||.:.:            ::
plant   216 NFLHFMAQHALIMQEELPSPQDEEGEEEDGRYHFMSLLLNLVN--TFLYMVNTYIIVPTADDYSM 278

  Fly   284 NIKVYETV-GVNQVLIFEVERRNAIGAMRALEI-----------SSFFGYMCTLSILLYL 331
            ::....|| ||            .||||...::           .|:|..:...||:|::
plant   279 SLGAAATVCGV------------VIGAMAVAQLFSSVYFSAWSNRSYFKPLIFSSIVLFI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898 35/162 (22%)
SPX 3..163 CDD:281146 35/162 (22%)
EXS 267..601 CDD:281164 16/89 (18%)
AT4G22990NP_001190805.1 SPX-MFS_plant 2..141 CDD:269900 38/174 (22%)
MFS 249..699 CDD:421695 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.