DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10481 and SPAC1D4.05c

DIOPT Version :9

Sequence 1:NP_995731.1 Gene:CG10481 / 35273 FlyBaseID:FBgn0032827 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_593018.1 Gene:SPAC1D4.05c / 2542527 PomBaseID:SPAC1D4.05c Length:387 Species:Schizosaccharomyces pombe


Alignment Length:381 Identity:88/381 - (23%)
Similarity:156/381 - (40%) Gaps:108/381 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 VDTSPEFRYTFVSLFRGPISGVTFGFCLAINIKVYETVGVNQVLIFEVERRNAIGAMRALEISSF 318
            ::.:.||:...||    |:. ...|:|.|..:.:....|   .::|..:.:..||.         
pombe    74 LEENTEFKANLVS----PVD-FHAGYCFAAILSISWATG---FILFLKKTQGDIGG--------- 121

  Fly   319 FGYMCTLSILLYLLHKEFFIEDPIYIPLVQV--AFVVVLFLNPFRILFYSGRIWLLTVMGRILLS 381
                      ||        ..||| ||:.|  ||::::|..|:|  :.|.:..|...:.|:.| 
pombe   122 ----------LY--------SHPIY-PLLWVITAFILIVFPFPWR--YRSSQRGLRKSIIRVFL- 164

  Fly   382 PFFFVNF----ADFWVADQWTSLVVTIVDHY--------YLVRFYVR--------YFLDRSDAFE 426
             ||..:|    .||.|::.:||....:.|.|        ::.:|.:|        :|:..:.|:.
pombe   165 -FFQADFRSPYKDFIVSEIFTSYAKALGDFYIFGCVLQGHISKFTLRPDLKCDGTFFVPLAMAYP 228

  Fly   427 FEPDYAVAVIRCLPAWFRFAQSLRR--FRDSGSKSTDYLINALKYFLFIAEVVFSTI------QM 483
            |    .||:::||    .:..|.|:  |:.:       |::|||:...:..:..|.|      :.
pombe   229 F----IVAILQCL----HYGLSRRKHTFKIN-------LLSALKHATALPVIYLSAIIHAKQTKF 278

  Fly   484 ETIAHYTDLFESPWTWAYITICIVSSIYTVFWDLLMDFGLFRVWNGENKFLR--DNLVYPRWFYY 546
            ...:.:..||     |.:|...::||.||..||:.:|      |.....|.:  ::..:|.:.|.
pombe   279 TLTSGHGYLF-----WLWILSALLSSAYTFLWDVFID------WRIRFPFHKSINHKRFPMFIYA 332

  Fly   547 FVIVENTLLRCVWILEF-ALVHQELIAPYNGKSLICFS----EIARRFFWNFLRLE 597
            .....|.:||..|.::. ..:||     ::...:..||    ||.|||.|.|..|:
pombe   333 IGCFINFILRVTWSMKLHPRLHQ-----FHEYEMGIFSFEMLEILRRFLWLFFHLD 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10481NP_995731.1 SPX_XPR1_like 2..163 CDD:269898
SPX 3..163 CDD:281146
EXS 267..601 CDD:281164 84/368 (23%)
SPAC1D4.05cNP_593018.1 COG5409 2..387 CDD:227696 88/381 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X439
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.