DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and RBM8A

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_005096.1 Gene:RBM8A / 9939 HGNCID:9905 Length:174 Species:Homo sapiens


Alignment Length:84 Identity:31/84 - (36%)
Similarity:46/84 - (54%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WI-FVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGI 98
            || ||.|.....||.|:...|::|||:.||:|..|.:||..||:..:.||..:....|::.|||.
Human    73 WILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQ 137

  Fly    99 KILDRTLRVDHVADYKPPK 117
            .::.:.:.||......|||
Human   138 DLMGQPISVDWCFVRGPPK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 28/78 (36%)
RBM8ANP_005096.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
RRM_RBM8 67..151 CDD:409762 28/77 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..174 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.