DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and NPL3

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_010720.3 Gene:NPL3 / 852042 SGDID:S000002840 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:123 Identity:28/123 - (22%)
Similarity:55/123 - (44%) Gaps:18/123 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EHELQHGGKKSWHDMYKD--SAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGF 77
            ||  .||.....|....:  :..:||..||..:.|.:|..:|..:|.:..:.::        .||
Yeast   106 EH--MHGRPPMHHRQEGELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKIL--------NGF 160

  Fly    78 CFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENEKMDEETLRLYMEGCA 135
            .|:.:|:..|...|::.::|....::.|.|.:   .|.|.:..::   |::...|||:
Yeast   161 AFVEFEEAESAAKAIEEVHGKSFANQPLEVVY---SKLPAKRYRI---TMKNLPEGCS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 18/89 (20%)
NPL3NP_010720.3 PHA03247 <11..87 CDD:223021
RBD_RRM1_NPL3 126..192 CDD:409777 17/73 (23%)
RRM2_SRSF1_4_like 200..271 CDD:409776 4/16 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.