DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AT1G73530

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_177494.1 Gene:AT1G73530 / 843687 AraportID:AT1G73530 Length:181 Species:Arabidopsis thaliana


Alignment Length:104 Identity:32/104 - (30%)
Similarity:50/104 - (48%) Gaps:10/104 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            ::|:|..:..||..|...|.|:|.::::|::.|....:.|||.||.||.:...:.|:..::| |.
plant    79 LYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLRYETEEEAMKAIQGMHG-KF 142

  Fly   101 LDRTLRVDHVADYKPPKENEKMDEETLRLYMEGCAPKPQ 139
            ||.  ||..|       |..|...:..|.......||||
plant   143 LDG--RVIFV-------EEAKTRSDMSRAKPRRDFPKPQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 25/76 (33%)
AT1G73530NP_177494.1 RRM 78..158 CDD:440488 27/88 (31%)

Return to query results.
Submit another query.