DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and CSTF64

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_177325.2 Gene:CSTF64 / 843510 AraportID:AT1G71800 Length:461 Species:Arabidopsis thaliana


Alignment Length:91 Identity:33/91 - (36%)
Similarity:48/91 - (52%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :||...||..||..|..:..:.|.||:..|:.|.:|||.||:.|..|:|:.:.:.|..||...:|
plant    11 VFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNLQSYEI 75

  Fly   101 LDRTLRVDHVADYKPPKENEKMDEET 126
            ..|.||||..       ||:|..::|
plant    76 NGRQLRVDFA-------ENDKGTDKT 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 29/76 (38%)
RRM <36..>126 CDD:223796 32/89 (36%)
CSTF64NP_177325.2 PABP-1234 <11..318 CDD:130689 33/91 (36%)
RRM_CSTF2_CSTF2T 11..85 CDD:241115 29/73 (40%)
CSTF2_hinge 160..228 CDD:373015
PAT1 <222..>433 CDD:370676
CSTF_C 419..454 CDD:373006
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.