DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Y14

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_564591.1 Gene:Y14 / 841576 AraportID:AT1G51510 Length:202 Species:Arabidopsis thaliana


Alignment Length:75 Identity:24/75 - (32%)
Similarity:40/75 - (53%) Gaps:1/75 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 W-IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGI 98
            | |.|:|......|.|:...|..:||:.|:||..|.::|..||:..:.||.:.....|:..:||.
plant    95 WIILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISAMNGA 159

  Fly    99 KILDRTLRVD 108
            ::|.:.:.||
plant   160 ELLTQNVSVD 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 24/75 (32%)
Y14NP_564591.1 RRM_RBM8 89..176 CDD:409762 24/75 (32%)

Return to query results.
Submit another query.