DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and RBP47A

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001321909.1 Gene:RBP47A / 841384 AraportID:AT1G49600 Length:450 Species:Arabidopsis thaliana


Alignment Length:88 Identity:32/88 - (36%)
Similarity:48/88 - (54%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 HGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYED 84
            |||..|..|...:::.|||.|....:||.||:..||.:||||::      |....||..|:.:.:
plant   313 HGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSV------KIPVGKGCGFVQFAN 371

  Fly    85 QRSTVLAVDNLNGIKILDRTLRV 107
            ::|...|:.||||..|...|:|:
plant   372 RQSAEEAIGNLNGTVIGKNTVRL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 29/83 (35%)
RBP47ANP_001321909.1 RRM1_SECp43_like 120..200 CDD:409780
RRM2_SECp43_like 212..291 CDD:409781
RRM_SF 326..397 CDD:473069 27/75 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.