DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and RBP47C

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_175180.1 Gene:RBP47C / 841157 AraportID:AT1G47490 Length:432 Species:Arabidopsis thaliana


Alignment Length:85 Identity:25/85 - (29%)
Similarity:42/85 - (49%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQ-YGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIK 99
            |||......:::..|...||: |..|....::.|:.||:|||:.|:.:.|:.....|:..:||:|
plant   199 IFVGDLSPDVSDNLLHETFSEKYPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAMTEMNGVK 263

  Fly   100 ILDRTLRVDHVADYKPPKEN 119
            ...|.:|:....   |.|.|
plant   264 CSSRAMRIGPAT---PRKTN 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 22/77 (29%)
RBP47CNP_175180.1 RRM1_SECp43_like 102..184 CDD:409780
RRM2_SECp43_like 196..275 CDD:409781 22/75 (29%)
RRM3_NGR1_NAM8_like 303..374 CDD:409782
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.