DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and SR34

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_850933.1 Gene:SR34 / 839262 AraportID:AT1G02840 Length:303 Species:Arabidopsis thaliana


Alignment Length:78 Identity:21/78 - (26%)
Similarity:38/78 - (48%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNL 95
            :.|..::|...|..:.|.::..:||:||.||.|:|   ....:..|:.|:.::|.|....|:...
plant     4 RSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDL---KVPPRPPGYAFVEFDDARDAEDAIHGR 65

  Fly    96 NGIKILDRTLRVD 108
            :|.......|||:
plant    66 DGYDFDGHRLRVE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 21/78 (27%)
SR34NP_850933.1 RRM1_SF2_plant_like 8..79 CDD:410011 20/74 (27%)
RRM2_SF2_plant_like 119..194 CDD:410014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.