DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AT5G54580

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_200269.1 Gene:AT5G54580 / 835546 AraportID:AT5G54580 Length:156 Species:Arabidopsis thaliana


Alignment Length:86 Identity:26/86 - (30%)
Similarity:43/86 - (50%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :||:|.....|...|...|:|:|||.:..::.|..:|.||||.|:.|.....:...:..::| |.
plant    58 LFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIAGMDG-KF 121

  Fly   101 LDRTLRVDHVADYKPPKENEK 121
            ||..:   ..|:|..|:|..:
plant   122 LDGWV---IFAEYARPREQSQ 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/76 (30%)
AT5G54580NP_200269.1 RRM 55..138 CDD:440488 26/83 (31%)

Return to query results.
Submit another query.