DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and PABN1

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001190511.1 Gene:PABN1 / 835186 AraportID:AT5G51120 Length:265 Species:Arabidopsis thaliana


Alignment Length:114 Identity:28/114 - (24%)
Similarity:52/114 - (45%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KNVLKLS-EHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKT 71
            :|:|:.. |.|:.:.|..:......||..|:|....|..|..::...|...|.|..:.::.| |.
plant   114 RNLLEFEYEKEIINSGVSAAEKEEVDSRSIYVGNVDYACTPEEVQQHFQSCGTVNRVTILTD-KF 177

  Fly    72 GKSKGFCFLCYED----QRSTVLAVDNLNG--IKILDRTLRVDHVADYK 114
            |:.|||.::.:.:    |.|.:|....|:|  ||:..:...|..:..::
plant   178 GQPKGFAYVEFVEVEAVQNSLILNESELHGRQIKVSAKRTNVPGMRQFR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/93 (25%)
PABN1NP_001190511.1 SF-CC1 <56..>213 CDD:273721 27/99 (27%)
RRM_II_PABPs 142..213 CDD:409747 20/71 (28%)

Return to query results.
Submit another query.