DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AT5G47620

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001190485.1 Gene:AT5G47620 / 834812 AraportID:AT5G47620 Length:453 Species:Arabidopsis thaliana


Alignment Length:130 Identity:33/130 - (25%)
Similarity:58/130 - (44%) Gaps:36/130 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVD--- 93
            :|..|||.|...::||.:....|:|:|.:.::.::.|.:|.:.:||.|:.|:.:.    |||   
plant   126 NSKKIFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISYDSEE----AVDKVL 186

  Fly    94 -----NLNGIKILDRTLRVDHVADYKPPKE------NEKMD---------EETLRLYMEGCAPKP 138
                 .||| |:::..|.|        ||:      ..:|:         ...|..|.:|.:|.|
plant   187 QKTFHELNG-KMVEVKLAV--------PKDMALNTMRNQMNVNSFGTSRISSLLNEYTQGFSPSP 242

  Fly   139  138
            plant   243  242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 25/88 (28%)
AT5G47620NP_001190485.1 RRM_SF 8..73 CDD:473069
RRM2_Hrp1p 129..206 CDD:409767 24/89 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.