DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10466 and Cstf2t

DIOPT Version :9

Sequence 1:	NP_001260601.1	Gene:	CG10466 / 35268	FlyBaseID:	FBgn0032822	Length:	154	Species:	Drosophila melanogaster
Sequence 2:	NP_112539.2	Gene:	Cstf2t / 83410	MGIID:	1932622	Length:	632	Species:	Mus musculus

Alignment Length:	83	Identity:	36/83 - (43%)
Similarity:	50/83 - (60%)	Gaps:	0/83 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :||...||..||..|..:||:.|.||:..|:.|.:|||.||:.|..|:||.:.:.|:.||||.:.
Mouse    18 VFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREF 82

  Fly   101 LDRTLRVDHVADYKPPKE 118
            ..|.||||:.|..|..:|
Mouse    83 SGRALRVDNAASEKNKEE 100

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10466	NP_001260601.1	RRM_ist3_like	25..113	CDD:240857	34/76 (45%)
CG10466	NP_001260601.1	RRM	<36..>126	CDD:223796	36/83 (43%)
Cstf2t	NP_112539.2	RRM	<16..>109	CDD:223796	36/83 (43%)
		RRM_CSTF2_CSTF2T	18..92	CDD:241115	33/73 (45%)
		CSTF2_hinge	113..191	CDD:291025
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..296
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	365..433
		8 X 5 AA tandem repeats of M-E-T-R-[AG]	428..466
		12 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q	508..565
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	519..590
		CSTF_C	588..628	CDD:291002
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	2	1.910