DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AtRZ-1c

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_196048.1 Gene:AtRZ-1c / 830307 AraportID:AT5G04280 Length:310 Species:Arabidopsis thaliana


Alignment Length:78 Identity:23/78 - (29%)
Similarity:48/78 - (61%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNL 95
            |:.:.|||.|....:|:.||...||::|::::..::.:..||:|:||.|:.:.|:|:...::..:
plant     4 KEGSRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREM 68

  Fly    96 NGIKILDRTLRVD 108
            :|....||.:.|:
plant    69 HGRDFGDRVISVN 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/78 (29%)
AtRZ-1cNP_196048.1 RRM 8..89 CDD:440488 22/74 (30%)
zf-CCHC 128..143 CDD:395050
U2AF_lg 170..>256 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.