DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and SR34b

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001328194.1 Gene:SR34b / 828027 AraportID:AT4G02430 Length:292 Species:Arabidopsis thaliana


Alignment Length:78 Identity:23/78 - (29%)
Similarity:38/78 - (48%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNL 95
            :.|..|:|...|..:.|.::..:||:||.||.|:|   ....:..|:.|:.:||.|....|:...
plant     4 RSSRTIYVGNLPGDIREREVEDLFSKYGPVVQIDL---KIPPRPPGYAFVEFEDARDADDAIYGR 65

  Fly    96 NGIKILDRTLRVD 108
            :|.......|||:
plant    66 DGYDFDGHHLRVE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/78 (29%)
SR34bNP_001328194.1 RRM1_SF2_plant_like 8..79 CDD:410011 22/74 (30%)
RRM2_SF2_plant_like 120..192 CDD:410014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.