DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AT4G20030

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_567594.1 Gene:AT4G20030 / 827748 AraportID:AT4G20030 Length:152 Species:Arabidopsis thaliana


Alignment Length:109 Identity:30/109 - (27%)
Similarity:51/109 - (46%) Gaps:20/109 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDN 94
            |..::.|.|...|::.:|..|...||.:||:..:.||:|....:|||:.|:.:..|....||::.
plant    36 YPLASKIMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIET 100

  Fly    95 LNGIKILDRTL---RVDHVADYKPPKEN-----------EKMDE 124
                  :||.:   |:.::...||.|.:           ||.||
plant   101 ------MDRRMYNGRMIYIDIAKPGKRDFQGLPRTSGPPEKSDE 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/85 (27%)
AT4G20030NP_567594.1 RRM 41..113 CDD:214636 22/77 (29%)

Return to query results.
Submit another query.