DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and GR-RBP2

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_193121.1 Gene:GR-RBP2 / 827019 AraportID:AT4G13850 Length:158 Species:Arabidopsis thaliana


Alignment Length:110 Identity:28/110 - (25%)
Similarity:54/110 - (49%) Gaps:18/110 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PLTNMKNVLKLSEHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIR 67
            |:|:|...|:|.                  |..:|:.|..:...:..|...|:.:|:||:..:|.
plant    22 PVTSMLGSLRLM------------------STKLFIGGLSWGTDDASLRDAFAHFGDVVDAKVIV 68

  Fly    68 DSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVAD 112
            |.:||:|:||.|:.:.|:.:...|:..::|.::..|.:||:...|
plant    69 DRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPAND 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/88 (26%)
GR-RBP2NP_193121.1 PLN03134 1..143 CDD:178680 28/110 (25%)

Return to query results.
Submit another query.