DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and CP29

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:82 Identity:24/82 - (29%)
Similarity:46/82 - (56%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            ::|....:.:.:..|..:|::.|:||...:|.|..:|:||||.|:.....:....|:::|||..:
plant   280 LYVGNLSWGVDDMALENLFNEQGKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADL 344

  Fly   101 LDRTLRVDHVADYKPPK 117
            ..|.:||.. |:.:||:
plant   345 DGRQIRVSE-AEARPPR 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 22/76 (29%)
CP29NP_001190079.1 U2AF_lg <45..>144 CDD:273727
RRM_SF 100..199 CDD:473069
RRM 278..361 CDD:440488 24/82 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.