DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AT3G47120

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_190296.1 Gene:AT3G47120 / 823865 AraportID:AT3G47120 Length:352 Species:Arabidopsis thaliana


Alignment Length:130 Identity:77/130 - (59%)
Similarity:99/130 - (76%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNPLTNMKNVLKLS--EHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNI 63
            |||||.:||:.|::  |.:|....:.|||..||:||:::|.|.|:.||||||:.|||||||:|::
plant     1 MNPLTQVKNLQKINARESDLGISDEASWHAKYKNSAYVYVGGIPFDLTEGDLLAVFSQYGEIVDV 65

  Fly    64 NLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENEKMDEETLR 128
            |||||..|||||||.||.|||||||:||||||||..:|.||::|||...|   |::|:.||||.|
plant    66 NLIRDKGTGKSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKVDHCGAY---KKHEEEDEETRR 127

  Fly   129  128
            plant   128  127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 59/87 (68%)
RRM <36..>126 CDD:223796 57/89 (64%)
AT3G47120NP_190296.1 RRM <16..>110 CDD:223796 58/93 (62%)
RRM_ist3_like 27..115 CDD:240857 59/87 (68%)
ZnF_C3H1 135..156 CDD:214632
ZnF_C3H1 185..206 CDD:214632
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 109 1.000 Domainoid score I2131
eggNOG 1 0.900 - - E1_KOG0126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484811at2759
OrthoFinder 1 1.000 - - FOG0004481
OrthoInspector 1 1.000 - - oto3645
orthoMCL 1 0.900 - - OOG6_102431
Panther 1 1.100 - - LDO PTHR45880
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3770
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.780

Return to query results.
Submit another query.