DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and GRP4

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_189025.1 Gene:GRP4 / 821966 AraportID:AT3G23830 Length:136 Species:Arabidopsis thaliana


Alignment Length:106 Identity:27/106 - (25%)
Similarity:50/106 - (47%) Gaps:18/106 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PLTNMKNVLKLSEHELQHGGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIR 67
            |:|:|...|:..                  |:.:||.|..:...:..|...|:.:|||....:|.
plant    22 PVTSMLGSLRYM------------------SSKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIA 68

  Fly    68 DSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVD 108
            |.:||:|:||.|:.:..:.|...|:..::|.::..|.:||:
plant    69 DRETGRSRGFGFVSFSCEDSANNAIKEMDGKELNGRQIRVN 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/84 (27%)
GRP4NP_189025.1 PLN03134 1..122 CDD:178680 27/106 (25%)

Return to query results.
Submit another query.