DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and RBP47B

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_188544.1 Gene:RBP47B / 821447 AraportID:AT3G19130 Length:435 Species:Arabidopsis thaliana


Alignment Length:115 Identity:35/115 - (30%)
Similarity:53/115 - (46%) Gaps:18/115 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TNMKNVLKLSEHELQ-------HG-----GKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQY 57
            |..:.:....:|..|       ||     |..|..|....:|.|||.|....:.:.||...|||:
plant   280 TPKRAIANQQQHSSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQF 344

  Fly    58 GEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRV 107
            ||||::      |....||..|:.:.|::|...|:::|||..|...|:|:
plant   345 GEVVSV------KIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 29/83 (35%)
RBP47BNP_188544.1 RRM1_SECp43_like 109..189 CDD:409780
RRM2_SECp43_like 201..280 CDD:409781 35/115 (30%)
RRM_SF 320..391 CDD:473069 27/75 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.