DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and SCL30A

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_187966.1 Gene:SCL30A / 820559 AraportID:AT3G13570 Length:262 Species:Arabidopsis thaliana


Alignment Length:90 Identity:27/90 - (30%)
Similarity:39/90 - (43%) Gaps:6/90 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :.|....:...:.||...|.|:|.|.:|.|.||..||..:||.|:.:.|......|...::|..:
plant    39 LLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKHQMDGYLL 103

  Fly   101 LDRTLRVDHVADYKPPKENEKMDEE 125
            |.|.|.|...      :||.|...|
plant   104 LGRELTVVFA------EENRKKPTE 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/76 (30%)
SCL30ANP_187966.1 RRM_SF 37..120 CDD:473069 26/86 (30%)
PABP-1234 <39..252 CDD:130689 27/90 (30%)

Return to query results.
Submit another query.