DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AT3G08000

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_187457.1 Gene:AT3G08000 / 819991 AraportID:AT3G08000 Length:143 Species:Arabidopsis thaliana


Alignment Length:140 Identity:34/140 - (24%)
Similarity:63/140 - (45%) Gaps:24/140 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MKNVLKLSEHEL----QHGGKKSWH--------DMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGE 59
            |||.::|....:    ||....|:|        .....|:.:|:.|..:::.|..|...||.:||
plant     2 MKNGIELLVRRVSAIPQHSISSSFHFLPQFCTSSSASPSSKLFIGGLSWSVDEQSLKDAFSSFGE 66

  Fly    60 VVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADY----------- 113
            |..:.:..|..:|:|:||.|:.:.::...:.|.|.::|..:|.|.||:....:.           
plant    67 VAEVRIAYDKGSGRSRGFGFVDFAEEGDALSAKDAMDGKGLLGRPLRISFALERVRGGPVVVPRL 131

  Fly   114 -KPPKENEKM 122
             |..:|.|::
plant   132 GKSKRERERV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 25/95 (26%)
RRM <36..>126 CDD:223796 25/99 (25%)
AT3G08000NP_187457.1 RRM_SF 42..117 CDD:418427 22/74 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.