DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AT2G43370

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_850395.1 Gene:AT2G43370 / 818938 AraportID:AT2G43370 Length:333 Species:Arabidopsis thaliana


Alignment Length:89 Identity:28/89 - (31%)
Similarity:46/89 - (51%) Gaps:3/89 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GGKKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQ 85
            |..|:..|.|   ..:||....:..||..|..|.|:||.:.|:.|:|...||.|:|:.|:.||.:
plant    54 GDSKAVGDPY---CTLFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRHIVTGASRGYGFVEYETE 115

  Fly    86 RSTVLAVDNLNGIKILDRTLRVDH 109
            :..:.|.::.:...|..|.:.||:
plant   116 KEMLRAYEDAHHSLIDGREIIVDY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 26/85 (31%)
AT2G43370NP_850395.1 RRM_snRNP35 60..150 CDD:409683 26/83 (31%)
U2AF_lg 218..>324 CDD:273727
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.