DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and AT2G37220

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:121 Identity:34/121 - (28%)
Similarity:53/121 - (43%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KNVLKLSEHELQHGG--------KKSWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNIN 64
            :||...||.|::..|        ::|:....|    :||...|:.:....|..:|...|.|..:.
plant    61 RNVAITSEFEVEEDGFADVAPPKEQSFSADLK----LFVGNLPFNVDSAQLAQLFESAGNVEMVE 121

  Fly    65 LIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENE 120
            :|.|..||:|:||.|:..........|....||.::..|.|||:  |...|||..:
plant   122 VIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRVN--AGPPPPKRED 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 25/87 (29%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:473069 24/83 (29%)
RRM 204..287 CDD:440488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.