DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and cirbpb

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001035411.2 Gene:cirbpb / 678563 ZFINID:ZDB-GENE-030131-5841 Length:206 Species:Danio rerio


Alignment Length:77 Identity:27/77 - (35%)
Similarity:45/77 - (58%) Gaps:0/77 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLN 96
            |...:|:.|..|..||..|...||:||.:..:::|||.:|.:|:||.|:.:|:......|:..:|
Zfish     3 DEGKLFIGGLSYDTTEQSLEEAFSKYGTIAKVDVIRDRETDRSRGFGFVTFENPEDAKDAMAAMN 67

  Fly    97 GIKILDRTLRVD 108
            |.::..|.:|||
Zfish    68 GKQVDGRMIRVD 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 27/77 (35%)
cirbpbNP_001035411.2 RRM_CIRBP_RBM3 5..83 CDD:409883 26/75 (35%)

Return to query results.
Submit another query.