DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and Rbm7

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_659197.2 Gene:Rbm7 / 67010 MGIID:1914260 Length:265 Species:Mus musculus


Alignment Length:111 Identity:29/111 - (26%)
Similarity:49/111 - (44%) Gaps:20/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :||......:||..|..:|.|.|.|:.:.:.:| |.||.|.|.|:.::.:.|...|::.|||||:
Mouse    12 LFVGNLETKVTEELLFELFHQAGPVIKVKIPKD-KDGKLKQFAFVNFKHEVSVPYAMNLLNGIKL 75

  Fly   101 LDRTLRVD-------------------HVADYKPPKENEKMDEETL 127
            ..|.:::.                   ||.:..|...:....|.|:
Mouse    76 FGRPIKIQFRSGSSHASQDASVSYPQHHVGNLSPTSTSPNSYERTV 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 26/95 (27%)
Rbm7NP_659197.2 RRM_RBM7 9..83 CDD:410005 24/71 (34%)
PABP-1234 <12..>175 CDD:130689 29/111 (26%)
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 25..35 3/9 (33%)
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 59..76 7/16 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..125 5/31 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..224
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..265
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.