DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and SRSF7

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001026854.1 Gene:SRSF7 / 6432 HGNCID:10789 Length:238 Species:Homo sapiens


Alignment Length:84 Identity:23/84 - (27%)
Similarity:37/84 - (44%) Gaps:5/84 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTV 89
            |.:..|.....::|........:|:|...||.||.:..:.:.|:     ..||.|:.:||.|...
Human     2 SRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARN-----PPGFAFVEFEDPRDAE 61

  Fly    90 LAVDNLNGIKILDRTLRVD 108
            .||..|:|..|....:||:
Human    62 DAVRGLDGKVICGSRVRVE 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 23/84 (27%)
SRSF7NP_001026854.1 RRM_SRSF7 12..88 CDD:410050 21/74 (28%)
Sufficient for interaction with NXF1 81..98 23/84 (27%)
zf-CCHC 104..119 CDD:395050
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..238
6 X 8 AA repeats of R-R-S-R-S-X-S-X 153..226
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.