DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and RBM4

DIOPT Version :10

Sequence 1:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens


Alignment Length:121 Identity:28/121 - (23%)
Similarity:51/121 - (42%) Gaps:25/121 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKI 100
            :|:...|...||.::..:|.|||:|:..::|        |.:.|:..||:.:...|:.||:..|:
Human     4 LFIGNLPREATEQEIRSLFEQYGKVLECDII--------KNYGFVHIEDKTAAEDAIRNLHHYKL 60

  Fly   101 LDRTLRVD------------HVADYKPPKENEKMDEETLRLYMEGCAPKPQLQHIK 144
            ....:.|:            ||.:..|...|::     ||...|...|..:...:|
Human    61 HGVNINVEASKNKSKTSTKLHVGNISPTCTNKE-----LRAKFEEYGPVIECDIVK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 21/88 (24%)
RBM4NP_002887.2 RRM1_RBM4 2..68 CDD:410018 18/71 (25%)
RRM2_RBM4 78..144 CDD:410019 9/39 (23%)
PTZ00368 <145..>181 CDD:173561
ZnF_C2HC 161..176 CDD:197667
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 196..364
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.