DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10466 and rbmx2

DIOPT Version :9

Sequence 1:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001016941.1 Gene:rbmx2 / 549695 XenbaseID:XB-GENE-5891739 Length:269 Species:Xenopus tropicalis


Alignment Length:166 Identity:92/166 - (55%)
Similarity:117/166 - (70%) Gaps:17/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNPLTNMKNVLKLSEHELQHGGKK--SWHDMYKDSAWIFVAGFPYTLTEGDLVCVFSQYGEVVNI 63
            |||||.:|.:.:|:..|...|.|.  |||..||||||:|:.|.||.|:|||::||||||||||||
 Frog     1 MNPLTKVKLINELNAREASLGVKDSVSWHQDYKDSAWLFIGGLPYELSEGDIICVFSQYGEVVNI 65

  Fly    64 NLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVADYKPPKENEKMDEETLR 128
            ||:||..:|:|:||||||:|||||||||||||||||:..||:||||||:|:|||:.|.:||.|..
 Frog    66 NLVRDKSSGRSRGFCFLCFEDQRSTVLAVDNLNGIKVKGRTIRVDHVANYRPPKDAEDIDEITQS 130

  Fly   129 LYMEGCAPK---------------PQLQHIKTEKKD 149
            |..:||..:               |:.:..|.:|||
 Frog   131 LREKGCGARTPSPVSSSQDEDEEPPRKKKDKKKKKD 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 66/87 (76%)
RRM <36..>126 CDD:223796 64/89 (72%)
rbmx2NP_001016941.1 RRM_ist3_like 27..115 CDD:240857 66/87 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 120 1.000 Domainoid score I5674
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484811at2759
OrthoFinder 1 1.000 - - FOG0004481
OrthoInspector 1 1.000 - - oto105153
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3770
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.